Kommunicera med leverantören? Leverantör
Daoke Wang Mr. Daoke Wang
Vad kan jag göra för dig?
Kontakta leverantören
Home > Produkter > EvoTec Medium Voltage Generator > 6300V Generator > Special högspännings 6300v generator
Special högspännings 6300v generator
Special högspännings 6300v generator
Special högspännings 6300v generator
  • Special högspännings 6300v generator
  • Special högspännings 6300v generator
  • Special högspännings 6300v generator

Special högspännings 6300v generator

    JÄMFÖRPRIS: USD 400 - 40000 / Set/Sets
    Betalning Typ: L/C,T/T
    Incoterm: FOB,CFR,CIF
    Min. Beställ: 1 Set/Sets
    Leverans Time: 20 dagar

Ladda ner:

Kontakta nu

Grundläggande information

Modell nr: TH468

Type: Basic Diesel Generator

Installation Method: Fixed

Cooling Method: Air Cooled

Output Type: AC Three Phase

Speed: Speed

Conditions of Use: Land Use

Usage: Common Units

Landuse Type of Unit: Ordinary

Excitation Mode: AC Rotating Exciter

Voltage:: 110V To 13800V

Phase:: Reconnect-able Single / 3

Frequency :: 50Hz / 60Hz

Degree Of Protection:: IP21 To IP55

Additional Info

Förpackning: träväska för 3-fas industrigenerator

Produktivitet: 1500 units monthly

Märke: Evotec

Transportfordon: Ocean,Land

Hemorten: Kina

Supply Förmåga: 2000 UNITS monthly

Certifikat: CE ISO9001 ISO14001

Hamn: Shanghai,WUHU


Special högspännings 6300v generator, 6300v trefas generator, Four Pole 6300v Generator, Synkron 6300v Generator har godkänt ISO9001 kvalitetsstyrningssystemcertifiering och ISO14001 Miljöstyrningssystemcertifiering. EvoTec

Tillhandahåller generatorer av hög kvalitet, erbjuder tillförlitliga, hållbara och bästa service.

6300V Generator Snabbinformation

Ursprungsplats: anhui , Kina (fastlandet)

Varumärke: EvoTec

Modellnummer: TH528E

Service Duty: Continuous Duty (S1) eller standby-drift

Nominell effekt: 1375kva / 1100kw

Standby Power: 1500kva / 1200kw

Märkspänning: 6300 v

Hastighet: 1500 varv / minut

Frekvens: 50 HZ

Terminalledningar: 6

Grad av skydd: IP23 / 21

isoleringsklass: standard H

Kraftfaktor: 0,8 släpar

Fas: Enkel / 3 kan anslutas igen
Pol: 4

Konstruktion: Enkel / dubbellager

Temperaturökning: 80 ° C till 163 ° C
omgivningstemperatur: 27 ° C till 60 ° C

Spänningsreglering: +/- 1%

Standardtekniska funktioner

Duty Rating

Continuous S1

Number of poles

Wind pitch



168 to 568

Phase sequence



up to 4000 KVA


6 to 12


50 HZ to 60HZ

Voltage regulation


Power factor

0.8 lagging


1500 rpm or 1800 rpm

Low voltage

110v to 690v

Maximum unbalance load


High voltage

3300v to 13800v


10% for 1 hour in every 12 hours

Direction of rotation

CW from drive end


1.25 times normal speed for 2 minutes

Harmonic distortion factor

<3% for three-phase

Degree of protection

IP22(IP23,IP44,IP55 on request)

Temperature rise class

Standard class H

Sustained short cut circuit

3 times at full load current

Insulation Class

Standard class H

6300v trefasgenerator

6300v Three Phase Generator

Four Pole 6300v Generator

Four Pole 6300v Generator

Synkron 6300v Generator

Synchronous 6300v Generator


Försörjningsförmåga: 1500 enheter per månad EvoTec medelspänningsgenerator

Förpackning och leverans

Förpackningsdetaljer: Träfodral 3-fas industriell generator

Hamn: Wuhu / Shanghai hamn

Ledtid: 7-30 dagar efter att du har betalat


EvoTec Power Generation Co., LTD är en professionell tillverkare av synkrongeneratorer, lågspänningsborstlös generator, 4-polig trefasgenerator, synkron växelströmsgenerator, högspänningsborstlös generator, dieselgenerator som integrerar forskning, design, produktion, försäljning av oss själv . Vi producerar trefasiga borstlösa självmagnetiserade växelströmsgeneratorer, intervallet från 20kVA till 3500kva, 50Hz / 60Hz alternativet, rpm 1500-1800, spänning 110V-13800V, klass H, IP23, lätt kopplas med alla märken av diesel eller bensin motorer och ånga eller hydrauliska turbiner, såsom världsklass av CUMMINS, Perkins, Lovol, Volvo Penta, MTU, Deutz, MAN, Caterpillar, Yanmar, Kubota, Lister Petter, Doosan, etc. Vår växelströmsgenerator används ofta inom industri, handel, fastigheter, sjukhus, hotell, järnväg, telekommunikation, datacentra och gruvdrift etc.



Högeffektiva tillverkare av fabrikstillverkare

Alternators WindingVpi Generator

Diesel Generators Alternator Fair Pictures



Industrial Generator Packed With Plywod Case

Produktkategorier : EvoTec Medium Voltage Generator > 6300V Generator

E-posta denna leverantör
  • Mr. Daoke Wang
  • Ditt meddelande måste vara mellan 20-8000 tecken

Lista över relaterade produkter



